Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KIF22 Rabbit Polyclonal Antibody (FITC)

KIF22 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

KID, OBP, KNSL4, OBP-1, OBP-2, SEMDJL2, A-328A3.2

UniProt

Q14807

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human KIF22

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: ILRHLLEGQNASVLAYGPTGAGKTHTMLGSPEQPGVIPRALMDLLQLTRE

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

73kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_015556

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Frizzled-6/FZD6 Protein (Fc Tag)
PKSH030518 100 µg

Recombinant Human Frizzled-6/FZD6 Protein (Fc Tag)

Sign In for Pricing
View Details
QuicKey Pro Human sST2 (Soluble ST2) ELISA Kit
E-OSEL-H0041-01 24 Tests

QuicKey Pro Human sST2 (Soluble ST2) ELISA Kit

Sign In for Pricing
View Details
QuicKey Pro Human sST2 (Soluble ST2) ELISA Kit
E-OSEL-H0041-02 48 Tests

QuicKey Pro Human sST2 (Soluble ST2) ELISA Kit

Sign In for Pricing
View Details
QuicKey Pro Human sST2 (Soluble ST2) ELISA Kit
E-OSEL-H0041-03 96 Tests

QuicKey Pro Human sST2 (Soluble ST2) ELISA Kit

Sign In for Pricing
View Details
IFluor® 633 goat anti-mouse IgG (H+L) *Cross Adsorbed*
16558-AAT 200 µg

IFluor® 633 goat anti-mouse IgG (H+L) *Cross Adsorbed*

Sign In for Pricing
View Details
Chloroform (Anhydrous) Contains Amylenes as stabilizer
TRC-C366491-500ML 500 mL

Chloroform (Anhydrous) Contains Amylenes as stabilizer

Sign In for Pricing
View Details