Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RGS16 Rabbit Polyclonal Antibody (HRP)

RGS16 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RGS-R, A28-RGS14, A28-RGS14P

UniProt

Q5VYN9

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human RGS16

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DAAQGKTRTLMEKDSYPRFLKSPAYRDLAAQASAASATLSSCSLDEPSHT

Field of Research

Metabolism Research

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

23kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_002919

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LHX3 Rabbit monoclonal antibody
BS41179-01 50 µL

LHX3 Rabbit monoclonal antibody

Sign In for Pricing
View Details
LHX3 Rabbit monoclonal antibody
BS41179-02 100 µL

LHX3 Rabbit monoclonal antibody

Sign In for Pricing
View Details
Nqo2 Antibody
A57545-100UG 100 µg

Nqo2 Antibody

Sign In for Pricing
View Details
Ocm siRNA Oligos set (Mouse)
32434174 3x 5 nmol

Ocm siRNA Oligos set (Mouse)

Sign In for Pricing
View Details
Human RNF7 Pre-designed siRNA Set A
SI013912A 1 Each

Human RNF7 Pre-designed siRNA Set A

Sign In for Pricing
View Details
(+) -alpha-Tocopherol sulfo-NHS succinate
291323-01 25 mg

(+) -alpha-Tocopherol sulfo-NHS succinate

Sign In for Pricing
View Details