Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RGS20 Rabbit Polyclonal Antibody (Biotin)

RGS20 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

RGSZ1, ZGAP1, gz-GAP, g (z) GAP

UniProt

O76081

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: NACCFCWCCCCSCSCLTVRNQEDQRPTIASHELRADLPTWEESPAPTLEE

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

27kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_003693

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal Cadherin-16 Antibody (CDH16/8800R)
NBP3-23879-20ug 20 µg

Rabbit Monoclonal Cadherin-16 Antibody (CDH16/8800R)

Sign In for Pricing
View Details
CHI3L1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K0444608 1.0 µg DNA

CHI3L1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Mouse Cone rod homeobox protein (CRX) ELISA Kit
GTR10354274 96 Well

Mouse Cone rod homeobox protein (CRX) ELISA Kit

Sign In for Pricing
View Details
hsa-miR-3655 Primers
MPH01498 150 µL - 10 µM

hsa-miR-3655 Primers

Sign In for Pricing
View Details
Recombinant Gorilla gorilla gorilla Taste receptor type 2 member 10 (TAS2R10), partial
MBS7086589 Inquire

Recombinant Gorilla gorilla gorilla Taste receptor type 2 member 10 (TAS2R10), partial

Sign In for Pricing
View Details
CD1E Rabbit Polyclonal Antibody (PE-Cy5)
orb961133 100 µL

CD1E Rabbit Polyclonal Antibody (PE-Cy5)

Sign In for Pricing
View Details