Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RGS20 Rabbit Polyclonal Antibody (Biotin)

RGS20 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

RGSZ1, ZGAP1, gz-GAP, g (z) GAP

UniProt

O76081

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human RGS20

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: NAFREFLRTEFSEENMLFWMACEELKKEANKNIIEEKARIIYEDYISILS

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_003693

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE-Linked Polyclonal Antibody to Runt Related Transcription Factor 3 (RUNX3)
MBS2118908-01 0.1 mL

PE-Linked Polyclonal Antibody to Runt Related Transcription Factor 3 (RUNX3)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Runt Related Transcription Factor 3 (RUNX3)
MBS2118908-02 0.2 mL

PE-Linked Polyclonal Antibody to Runt Related Transcription Factor 3 (RUNX3)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Runt Related Transcription Factor 3 (RUNX3)
MBS2118908-03 0.5 mL

PE-Linked Polyclonal Antibody to Runt Related Transcription Factor 3 (RUNX3)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Runt Related Transcription Factor 3 (RUNX3)
MBS2118908-04 1 mL

PE-Linked Polyclonal Antibody to Runt Related Transcription Factor 3 (RUNX3)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Runt Related Transcription Factor 3 (RUNX3)
MBS2118908-05 5 mL

PE-Linked Polyclonal Antibody to Runt Related Transcription Factor 3 (RUNX3)

Sign In for Pricing
View Details
PDCL (Phosducin-like Protein, PhLP) (MaxLight 490)
MBS6430880-01 0.1 mL

PDCL (Phosducin-like Protein, PhLP) (MaxLight 490)

Sign In for Pricing
View Details