Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RGS20 Rabbit Polyclonal Antibody (HRP)

RGS20 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RGSZ1, ZGAP1, gz-GAP, g (z) GAP

UniProt

O76081

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human RGS20

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KHFSRPSIWTQFLPLFRAQRYNTDIHQITENEGDLRAVPDIKSFPPAQLP

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

44kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_733466

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSP60 (Heat Shock Protein 60) (Mitochondrial Marker) (HSPD1/2206R), CF568 conjugate, 0.1mg/mL
BNC682206-500 1x 500 µL

HSP60 (Heat Shock Protein 60) (Mitochondrial Marker) (HSPD1/2206R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PE Anti-Mouse CD335/NKp46 Antibody[29A1.4]
E-AB-F1182UD-01 25 µg

PE Anti-Mouse CD335/NKp46 Antibody[29A1.4]

Sign In for Pricing
View Details
PE Anti-Mouse CD335/NKp46 Antibody[29A1.4]
E-AB-F1182UD-02 100 µg

PE Anti-Mouse CD335/NKp46 Antibody[29A1.4]

Sign In for Pricing
View Details
MAP3K10 (NM_002446) Human Over-expression Lysate
LY419320 100 µg

MAP3K10 (NM_002446) Human Over-expression Lysate

Sign In for Pricing
View Details
ZHX2 Mouse Monoclonal Antibody [Clone ID: OTI2E2]
CF810730 100 µg

ZHX2 Mouse Monoclonal Antibody [Clone ID: OTI2E2]

Sign In for Pricing
View Details
Cyclin A2 (E67), CF488A conjugate, 0.1mg/mL
BNC880673-100 1x 100 µL

Cyclin A2 (E67), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details