Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ppara Rabbit Polyclonal Antibody (FITC)

Ppara Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

PPAR

UniProt

P37230

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LHLQSNHPDDTFLFPKLLQKMVDLRQLVTEHAQLVQVIKKTESDAALHPL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

51kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_037328

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OPALIN CRISPRa sgRNA lentivector (set of three targets)(Rat)
34837126 3x 1.0µg DNA

OPALIN CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
Mouse Monoclonal Glut5 Antibody (OTI9F3) [Dylight 594]
NBP2-71285DL594 0.1 mL

Mouse Monoclonal Glut5 Antibody (OTI9F3) [Dylight 594]

Sign In for Pricing
View Details
KIF18A Antibody
58-460 400 µL

KIF18A Antibody

Sign In for Pricing
View Details
MILK2 Antibody
61-703 400 µL

MILK2 Antibody

Sign In for Pricing
View Details
ZDHHC13, NT (ZDHHC13, HIP14L, HIP3RP, Palmitoyltransferase ZDHHC13, Huntingtin-interacting protein 14-related protein, Huntingtin-interacting protein HIP3RP, Putative MAPK-activating protein PM03, Putative NF-kappa-B-activating protein 209, Zinc finger DH
MBS6365025-01 0.1 mL

ZDHHC13, NT (ZDHHC13, HIP14L, HIP3RP, Palmitoyltransferase ZDHHC13, Huntingtin-interacting protein 14-related protein, Huntingtin-interacting protein HIP3RP, Putative MAPK-activating protein PM03, Putative NF-kappa-B-activating protein 209, Zinc finger DH

Sign In for Pricing
View Details
ZDHHC13, NT (ZDHHC13, HIP14L, HIP3RP, Palmitoyltransferase ZDHHC13, Huntingtin-interacting protein 14-related protein, Huntingtin-interacting protein HIP3RP, Putative MAPK-activating protein PM03, Putative NF-kappa-B-activating protein 209, Zinc finger DH
MBS6365025-02 5x 0.1 mL

ZDHHC13, NT (ZDHHC13, HIP14L, HIP3RP, Palmitoyltransferase ZDHHC13, Huntingtin-interacting protein 14-related protein, Huntingtin-interacting protein HIP3RP, Putative MAPK-activating protein PM03, Putative NF-kappa-B-activating protein 209, Zinc finger DH

Sign In for Pricing
View Details