Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KIF2B Rabbit Polyclonal Antibody (HRP)

KIF2B Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q8N4N8

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human KIF2B

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DCSKGIYALVAQDVFLLLRNSTYEKLDLKVYGTFFEIYGGKVYDLLNWKK

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

76kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_115948

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MRX11 Adenovirus (Human)
30638051 1.0 mL

MRX11 Adenovirus (Human)

Sign In for Pricing
View Details
Rat Monoclonal PGLYRP2/PGRP-L Antibody (439728) [Alexa Fluor 750]
FAB4704S 0.1 mL

Rat Monoclonal PGLYRP2/PGRP-L Antibody (439728) [Alexa Fluor 750]

Sign In for Pricing
View Details
HSPA1L CRISPRa sgRNA lentivector (set of three targets)(Rat)
24000126 3x 1.0µg DNA

HSPA1L CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
Lentiviral human APOF shRNA (UAS) - Lentiviral human APOF shRNA (UAS, iRFP) plasmid
GTR15102316 1 Vial

Lentiviral human APOF shRNA (UAS) - Lentiviral human APOF shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
SLC25A40 Antibody (FITC)
orb356769-01 50 µg

SLC25A40 Antibody (FITC)

Sign In for Pricing
View Details
SLC25A40 Antibody (FITC)
orb356769-02 100 µg

SLC25A40 Antibody (FITC)

Sign In for Pricing
View Details