Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PARP6 Rabbit Polyclonal Antibody (HRP)

PARP6 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ARTD17, pART17, PARP-6-C, PARP-6-B1

UniProt

Q2NL67

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human PARP6

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KLPLSRLKFMHTSHQFLLLSSPPAKEARFRTAKKLYGSTFAFHGSHIENW

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

59kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_064599

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rat CD23 Protein (Fc Tag)
PKSR030317-01 100 µg

Recombinant Rat CD23 Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Rat CD23 Protein (Fc Tag)
PKSR030317-02 1 mg

Recombinant Rat CD23 Protein (Fc Tag)

Sign In for Pricing
View Details
EID3 (NM_001008394) Human Over-expression Lysate
LC423421 20 µg

EID3 (NM_001008394) Human Over-expression Lysate

Sign In for Pricing
View Details
CD59 / Complement Regulatory Protein / Protectin (MACIF/2867R), CF594 conjugate, 0.1mg/mL
BNC942867-100 1x 100 µL

CD59 / Complement Regulatory Protein / Protectin (MACIF/2867R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cyclin D2 (CCND2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5H6]
TA806169AM 100 µL

Cyclin D2 (CCND2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5H6]

Sign In for Pricing
View Details
FRS2 Antibody
KC-28559-01 50 μL

FRS2 Antibody

Sign In for Pricing
View Details