Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NPM1 Rabbit Polyclonal Antibody (HRP)

NPM1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

B23, NPM

UniProt

P06748

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human NPM1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKD

Field of Research

Cell Biology

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_002511

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BAT3 (BAG6) (NM_001098534) Human Over-expression Lysate
LC420631 20 µg

BAT3 (BAG6) (NM_001098534) Human Over-expression Lysate

Sign In for Pricing
View Details
Fibronectin (HFN7.1), CF594 conjugate, 0.1mg/mL
BNC940270-100 1x 100 µL

Fibronectin (HFN7.1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
LBH Rabbit Polyclonal Antibody
TA366623 100 µL

LBH Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
RAMP2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4E5]
TA504410BM 100 µL

RAMP2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4E5]

Sign In for Pricing
View Details
2,3-Pyrazinedicarboxylic Acid
TRC-P840810-5G 5 g

2,3-Pyrazinedicarboxylic Acid

Sign In for Pricing
View Details
Human Kappa Light Chain / IGKC (B-Cell Marker) (KLC2289R), CF594 conjugate, 0.1mg/mL
BNC942289-500 1x 500 µL

Human Kappa Light Chain / IGKC (B-Cell Marker) (KLC2289R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details