Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NPM1 Rabbit Polyclonal Antibody (Biotin)

NPM1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

B23, NPM

UniProt

P06748

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human NPM1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: VSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEEEEDVKLL

Field of Research

Cell Biology

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_002511

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Armenian Hamster Monoclonal IL-10 R alpha Antibody (RM0101-9E12) [Alexa Fluor 750]
NBP1-22459AF750 0.1 mL

Armenian Hamster Monoclonal IL-10 R alpha Antibody (RM0101-9E12) [Alexa Fluor 750]

Sign In for Pricing
View Details
Lentiviral human USP24 sgRNA gene knockout kit - Lentiviral human USP24 sgRNA gene knockout kit (plasmid)
GTR15391676 1 Vial

Lentiviral human USP24 sgRNA gene knockout kit - Lentiviral human USP24 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
NARSP sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
62493111 3x 1.0 µg

NARSP sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
FAM91A1 Rabbit Polyclonal Antibody
orb3069480-01 30 µL

FAM91A1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FAM91A1 Rabbit Polyclonal Antibody
orb3069480-02 50 µL

FAM91A1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FAM91A1 Rabbit Polyclonal Antibody
orb3069480-03 100 µL

FAM91A1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details