Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTGER3 Rabbit Polyclonal Antibody (HRP)

PTGER3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

EP3, EP3e, EP3-I, EP3-II, EP3-IV, EP3-VI, PGE2-R, EP3-III, lnc003875

UniProt

P43115

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human PTGER3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LDPWVYLLLRKILLRKFCQIRYHTNNYASSSTSLPCQCSSTLMWSDHLER

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

43kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Human, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_942007

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glutathione S Transferase theta 2 (GSTT2B) (NM_001080843) Human Over-expression Lysate
LS653689-100ug 100 µg

Glutathione S Transferase theta 2 (GSTT2B) (NM_001080843) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Human GBP6 Protein, N-His
HB361012-01 50 µg

Recombinant Human GBP6 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human GBP6 Protein, N-His
HB361012-02 100 µg

Recombinant Human GBP6 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human GBP6 Protein, N-His
HB361012-03 1 mg

Recombinant Human GBP6 Protein, N-His

Sign In for Pricing
View Details
Complement C3 (C3a desAr, Acylation Stimulating protein, ASP, C3, PZP-like alpha-2-macroglobulin domain-containing protein 1, CO3) (Biotin)
MBS6261481-01 0.1 mL

Complement C3 (C3a desAr, Acylation Stimulating protein, ASP, C3, PZP-like alpha-2-macroglobulin domain-containing protein 1, CO3) (Biotin)

Sign In for Pricing
View Details
Complement C3 (C3a desAr, Acylation Stimulating protein, ASP, C3, PZP-like alpha-2-macroglobulin domain-containing protein 1, CO3) (Biotin)
MBS6261481-02 5x 0.1 mL

Complement C3 (C3a desAr, Acylation Stimulating protein, ASP, C3, PZP-like alpha-2-macroglobulin domain-containing protein 1, CO3) (Biotin)

Sign In for Pricing
View Details