Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTGER3 Rabbit Polyclonal Antibody (FITC)

PTGER3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

EP3, EP3e, EP3-I, EP3-II, EP3-IV, EP3-VI, PGE2-R, EP3-III, lnc003875

UniProt

P43115

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PTGER3

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: ILDPWVYLLLRKILLRKFCQIRYHTNNYASSSTSLPCQCSSTLMWSDHLE

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

43kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Human, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_942012

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE anti-human CD45
GT07864 100 Tests

PE anti-human CD45

Sign In for Pricing
View Details
Bovine Epidermal Fatty Acid Binding Protein (eFABP) ELISA Kit
EIA06629Bo 1 Kit

Bovine Epidermal Fatty Acid Binding Protein (eFABP) ELISA Kit

Sign In for Pricing
View Details
LexA, DNA-Binding Region (MaxLight 750) discontinued
L2060-ML750 100 µL

LexA, DNA-Binding Region (MaxLight 750) discontinued

Sign In for Pricing
View Details
Lentiviral mouse Tbc1d22b shRNA (UAS) - Lentiviral mouse Tbc1d22b shRNA (UAS, iRFP) plasmid
GTR15255844 1 Vial

Lentiviral mouse Tbc1d22b shRNA (UAS) - Lentiviral mouse Tbc1d22b shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Cow IgG Antibody
E3M00003 200 µL

Cow IgG Antibody

Sign In for Pricing
View Details
TriMethyl-Histone H3 (Lys9) Rabbit mAb, 1 pack = 50 µL
BAL2956 1 Each

TriMethyl-Histone H3 (Lys9) Rabbit mAb, 1 pack = 50 µL

Sign In for Pricing
View Details