Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTGER3 Rabbit Polyclonal Antibody (Biotin)

PTGER3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

EP3, EP3e, EP3-I, EP3-II, EP3-IV, EP3-VI, PGE2-R, EP3-III, lnc003875

UniProt

P43115

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PTGER3

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: ILDPWVYLLLRKILLRKFCQIRYHTNNYASSSTSLPCQCSSTLMWSDHLE

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

43kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Human, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_942012

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Kif18a shRNA (UAS) - Lentiviral mouse Kif18a shRNA (UAS, iRFP) (25)
GTR15200786 1 Vial

Lentiviral mouse Kif18a shRNA (UAS) - Lentiviral mouse Kif18a shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
CRYL1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
16894066 1.0 µg DNA

CRYL1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
WDPCP Peptide - N-terminal region (AAP56279)
AAP56279-100UG 100 µg

WDPCP Peptide - N-terminal region (AAP56279)

Sign In for Pricing
View Details
Lentiviral human APOA4 sgRNA gene knockout kit - Lentiviral human APOA4 sgRNA gene knockout kit (25)
GTR15364767 1 Vial

Lentiviral human APOA4 sgRNA gene knockout kit - Lentiviral human APOA4 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
CD3 (Early T Cell Marker, T Cell receptor Complex, TCR) (MaxLight 750)
MBS6259959-01 0.1 mL

CD3 (Early T Cell Marker, T Cell receptor Complex, TCR) (MaxLight 750)

Sign In for Pricing
View Details
CD3 (Early T Cell Marker, T Cell receptor Complex, TCR) (MaxLight 750)
MBS6259959-02 5x 0.1 mL

CD3 (Early T Cell Marker, T Cell receptor Complex, TCR) (MaxLight 750)

Sign In for Pricing
View Details