Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPARA Rabbit Polyclonal Antibody (HRP)

PPARA Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Anon-EST:Liang-1.32, CG18103, CG31608, CG44122, CG8486, clone 1.32, Dmel\CG44122, Dmpiezo, DmPiezo, DmPIEZO, fos28F, fos500, OrfKD, piezo

UniProt

Q07869

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PPARA

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SEKAKLKAEILTCEHDIEDSETADLKSLAKRIYEAYLKNFNMNKVKARVI

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

51kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Human, Mouse, Porcine, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_005027

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

CPTI siRNA (h)
sc-40376 10 µM

CPTI siRNA (h)

Sign In for Pricing
View Details
KCTD6, ID (KCTD6, BTB/POZ domain-containing protein KCTD6) (APC)
MBS6312919-01 0.2 mL

KCTD6, ID (KCTD6, BTB/POZ domain-containing protein KCTD6) (APC)

Sign In for Pricing
View Details
KCTD6, ID (KCTD6, BTB/POZ domain-containing protein KCTD6) (APC)
MBS6312919-02 5x 0.2 mL

KCTD6, ID (KCTD6, BTB/POZ domain-containing protein KCTD6) (APC)

Sign In for Pricing
View Details
USH1A 3'UTR Luciferase Stable Cell Line
TU027902 1.0 mL

USH1A 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
PCD513B-1-CD30 (C297R)
PPL00715-4a 1 Each

PCD513B-1-CD30 (C297R)

Sign In for Pricing
View Details
Siglec 7, NT (Sialic Acid-binding Ig-like Lectin 7, Siglec 7, QA79 Membrane Protein, Adhesion Inhibitory Receptor Molecule-1, AIRM-1, p75, D-siglec, AIRM1, D-siglec, CDw328, CD328) (MaxLight 650) discontinued
S1013-60B-ML650 100 µL

Siglec 7, NT (Sialic Acid-binding Ig-like Lectin 7, Siglec 7, QA79 Membrane Protein, Adhesion Inhibitory Receptor Molecule-1, AIRM-1, p75, D-siglec, AIRM1, D-siglec, CDw328, CD328) (MaxLight 650) discontinued

Sign In for Pricing
View Details