Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPARA Rabbit Polyclonal Antibody (HRP)

PPARA Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PPAR, NR1C1, hPPAR, PPARalpha, PPAR-alpha

UniProt

Q07869

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PPARA

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: IYEAYLKNFNMNKVKARVILSGKASNNPPFVIHDMETLCMAEKTLVAKLV

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

51kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Goat, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_005027

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

APBB1 Protein Vector (Mouse) (pPM-C-His)
PV155101 500 ng

APBB1 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Mouse Smad3 Pre-designed siRNA Set A
SI113370A 1 Each

Mouse Smad3 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Anti-Zebrafish Alpha A Crystallin/CRYAA Antibody Picoband® Fluoro488 Conjugated
AZQ8UUZ6-Fluoro488 100 µg/Vial

Anti-Zebrafish Alpha A Crystallin/CRYAA Antibody Picoband® Fluoro488 Conjugated

Sign In for Pricing
View Details
Mmu-miR-7060-5p miRNA Inhibitor
orb1869329-01 10 nmol

Mmu-miR-7060-5p miRNA Inhibitor

Sign In for Pricing
View Details
Mmu-miR-7060-5p miRNA Inhibitor
orb1869329-02 20 nmol

Mmu-miR-7060-5p miRNA Inhibitor

Sign In for Pricing
View Details
Calretinin Antibody
orb319473 100 µL

Calretinin Antibody

Sign In for Pricing
View Details