Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPARA Rabbit Polyclonal Antibody (Biotin)

PPARA Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

PPAR, NR1C1, hPPAR, PPARalpha, PPAR-alpha

UniProt

Q07869

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PPARA

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: IYEAYLKNFNMNKVKARVILSGKASNNPPFVIHDMETLCMAEKTLVAKLV

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

51kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Goat, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_005027

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human AXIN1 sgRNA gene knockout kit - Lentiviral human AXIN1 sgRNA gene knockout kit (plasmid)
GTR15376616 1 Vial

Lentiviral human AXIN1 sgRNA gene knockout kit - Lentiviral human AXIN1 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
4- (4-Formylphenyl) -2-nitrobenzoic acid
429187-01 100 mg

4- (4-Formylphenyl) -2-nitrobenzoic acid

Sign In for Pricing
View Details
4- (4-Formylphenyl) -2-nitrobenzoic acid
429187-02 250 mg

4- (4-Formylphenyl) -2-nitrobenzoic acid

Sign In for Pricing
View Details
Lentiviral mouse Rasa3 shRNA (UAS) - Lentiviral mouse Rasa3 shRNA (UAS, iRFP) plasmid
GTR15181816 1 Vial

Lentiviral mouse Rasa3 shRNA (UAS) - Lentiviral mouse Rasa3 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
TCF1 (T-cell Factor 1) (MaxLight 750)
MBS6247165-01 0.1 mL

TCF1 (T-cell Factor 1) (MaxLight 750)

Sign In for Pricing
View Details
TCF1 (T-cell Factor 1) (MaxLight 750)
MBS6247165-02 5x 0.1 mL

TCF1 (T-cell Factor 1) (MaxLight 750)

Sign In for Pricing
View Details