Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

G22P1 Rabbit Polyclonal Antibody (FITC)

G22P1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

ML8, KU70, TLAA, CTC75, CTCBF, G22P1

UniProt

Q6FG89

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human G22P1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MSGWESYYKTEGDEEAEEEQEENLEASGDYKYSGRDSLIFLVDASKAMFE

Field of Research

Epigenetics & Chromatin

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

70kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Human

Tested Applications

WB

NCBI Accession Number

NP_001460

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RING1 Rabbit Polyclonal Antibody
TA380931 100 µL

RING1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
HNRNPD (NM_002138) Human Recombinant Protein
TP760280 50 µg

HNRNPD (NM_002138) Human Recombinant Protein

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary
CS508318 5x 5 µm

Frozen Tissue Sections, Ovary

Sign In for Pricing
View Details
Recombinant Human MFAP4 Protein (His Tag)
PKSH032754-01 10 µg

Recombinant Human MFAP4 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human MFAP4 Protein (His Tag)
PKSH032754-02 50 µg

Recombinant Human MFAP4 Protein (His Tag)

Sign In for Pricing
View Details
PI 3 Kinase Class 2A (PIK3C2A) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2C11]
TA801725AM 100 µL

PI 3 Kinase Class 2A (PIK3C2A) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2C11]

Sign In for Pricing
View Details