Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

G22P1 Rabbit Polyclonal Antibody (HRP)

G22P1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ML8, KU70, TLAA, CTC75, CTCBF, G22P1

UniProt

Q6FG89

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human G22P1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MSGWESYYKTEGDEEAEEEQEENLEASGDYKYSGRDSLIFLVDASKAMFE

Field of Research

Epigenetics & Chromatin

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

70kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Human

Tested Applications

WB

NCBI Accession Number

NP_001460

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

B7-H4 (Immuno-Inhibitory Protein) (B7H4/1788), CF640R conjugate, 0.1mg/mL
BNC401788-500 1x 500 µL

B7-H4 (Immuno-Inhibitory Protein) (B7H4/1788), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Primer Panel
HPP6021A 3x 96 Pre-Arrayed Plates

Primer Panel

Sign In for Pricing
View Details
Human STARD6 activation kit by CRISPRa
GA115603 1 Kit

Human STARD6 activation kit by CRISPRa

Sign In for Pricing
View Details
Acetamidine Hydroiodide
TRC-A133073-50MG 50 mg

Acetamidine Hydroiodide

Sign In for Pricing
View Details
Anti-V5 (GKPIPNPLLGLDST) FAST IP kit (Agarose)
EA-IP-K005 50 Tests

Anti-V5 (GKPIPNPLLGLDST) FAST IP kit (Agarose)

Sign In for Pricing
View Details
TFIIF (GTF2F2) Human Gene Knockout Kit (CRISPR)
KN400361 1 Kit

TFIIF (GTF2F2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details