Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

G22P1 Rabbit Polyclonal Antibody (HRP)

G22P1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ML8, KU70, TLAA, CTC75, CTCBF, G22P1

UniProt

Q6FG89

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human G22P1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MSGWESYYKTEGDEEAEEEQEENLEASGDYKYSGRDSLIFLVDASKAMFE

Field of Research

Epigenetics & Chromatin

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

70kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Human

Tested Applications

WB

NCBI Accession Number

NP_001460

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human TSLP (C-10His)
PKSH033888-01 10 µg

Recombinant Human TSLP (C-10His)

Sign In for Pricing
View Details
Recombinant Human TSLP (C-10His)
PKSH033888-02 50 µg

Recombinant Human TSLP (C-10His)

Sign In for Pricing
View Details
CD35 / CR1 (Follicular Dendritic Cell Marker) (To5), 0.2mg/mL
BNUB1318-100 1x 100 µL

CD35 / CR1 (Follicular Dendritic Cell Marker) (To5), 0.2mg/mL

Sign In for Pricing
View Details
PIP4P2 (NM_018710) Human Over-expression Lysate
LC402708 20 µg

PIP4P2 (NM_018710) Human Over-expression Lysate

Sign In for Pricing
View Details
CD82 Mouse Monoclonal Antibody [Clone ID: B-L2]
AM31359PU-N 2 mL (200 Tests)

CD82 Mouse Monoclonal Antibody [Clone ID: B-L2]

Sign In for Pricing
View Details
Human RGPD2 activation kit by CRISPRa
GA119026 1 Kit

Human RGPD2 activation kit by CRISPRa

Sign In for Pricing
View Details