Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

XRCC5 Rabbit Polyclonal Antibody (Biotin)

XRCC5 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

KU80, KUB2, Ku86, NFIV, KARP1, KARP-1

UniProt

Q4VBQ5

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human XRCC5

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: GITLITKEEASGSSVTAEEAKKFLAPKDKPSGDTAAVFEEGGDVDDLLDM

Field of Research

Epigenetics & Chromatin

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

83kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_066964

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human RXRA Protein, N-His
ARO-P12436-01 50 µg

Recombinant Human RXRA Protein, N-His

Sign In for Pricing
View Details
Recombinant Human RXRA Protein, N-His
ARO-P12436-02 100 µg

Recombinant Human RXRA Protein, N-His

Sign In for Pricing
View Details
Recombinant Human RXRA Protein, N-His
ARO-P12436-03 1 mg

Recombinant Human RXRA Protein, N-His

Sign In for Pricing
View Details
Olr1117 Protein Vector (Rat) (pPM-C-His)
PV287149 500 ng

Olr1117 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
RNF114 (RING Finger Protein 114)
490640 100 µL

RNF114 (RING Finger Protein 114)

Sign In for Pricing
View Details
1-O-Methyl-alpha-D-galactopyranoside monohydrate
MM05301-01 0.1 Kg

1-O-Methyl-alpha-D-galactopyranoside monohydrate

Sign In for Pricing
View Details