Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RCOR3 Rabbit Polyclonal Antibody (HRP)

RCOR3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FLJ10876, FLJ16298, RP11-318L16.1

UniProt

Q9P2K3

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human RCOR3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QARKLANRHNQGDSDDDVEETHPMDGNDSDYDPKKEAKKEGNTEQPVQTS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

55kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_060724

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Internexin, alpha, ID (INA, 66kD Neurofilament Protein, Alpha-Internexin, Alpha Inx, FLJ18662, FLJ57501, MGC12702, NEF 5, NEF5, Neurofilament 5, Neurofilament 66, Neurofilament-66 NF 66, NF66, NF-66) (MaxLight 750)
MBS6483312-01 0.1 mL

Internexin, alpha, ID (INA, 66kD Neurofilament Protein, Alpha-Internexin, Alpha Inx, FLJ18662, FLJ57501, MGC12702, NEF 5, NEF5, Neurofilament 5, Neurofilament 66, Neurofilament-66 NF 66, NF66, NF-66) (MaxLight 750)

Sign In for Pricing
View Details
Internexin, alpha, ID (INA, 66kD Neurofilament Protein, Alpha-Internexin, Alpha Inx, FLJ18662, FLJ57501, MGC12702, NEF 5, NEF5, Neurofilament 5, Neurofilament 66, Neurofilament-66 NF 66, NF66, NF-66) (MaxLight 750)
MBS6483312-02 5x 0.1 mL

Internexin, alpha, ID (INA, 66kD Neurofilament Protein, Alpha-Internexin, Alpha Inx, FLJ18662, FLJ57501, MGC12702, NEF 5, NEF5, Neurofilament 5, Neurofilament 66, Neurofilament-66 NF 66, NF66, NF-66) (MaxLight 750)

Sign In for Pricing
View Details
MCM7 Recombinant Rabbit mAb
BS45348-01 50 µL

MCM7 Recombinant Rabbit mAb

Sign In for Pricing
View Details
MCM7 Recombinant Rabbit mAb
BS45348-02 100 µL

MCM7 Recombinant Rabbit mAb

Sign In for Pricing
View Details
Anti-IRF3 Antibody Picoband® (monoclonal, 3B4) Fluoro594 Conjugated
M00165-3-Fluoro594 100 µg/Vial

Anti-IRF3 Antibody Picoband® (monoclonal, 3B4) Fluoro594 Conjugated

Sign In for Pricing
View Details
(R) - (+) -HA-966
T12637-01 5 mg

(R) - (+) -HA-966

Sign In for Pricing
View Details