Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C19ORF6 Rabbit Polyclonal Antibody (Biotin)

C19ORF6 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

MBRL, ASBABP1, C19orf6, R32184_3, MEMBRALIN

UniProt

Q4ZIN3

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human C19ORF6

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: YDDILMSSVKGLAENEENKGFLRNVVSGEHYRFVSMWMARTSYLAAFAIM

Field of Research

Cell Biology

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_219488

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Scn4b Mouse Pre-designed siRNA Set A
HY-RS21043 1 Set

Scn4b Mouse Pre-designed siRNA Set A

Sign In for Pricing
View Details
Recombinant Calloselasma rhodostoma Snaclec rhodocytin subunit beta
orb1631287-01 20 µg

Recombinant Calloselasma rhodostoma Snaclec rhodocytin subunit beta

Sign In for Pricing
View Details
Recombinant Calloselasma rhodostoma Snaclec rhodocytin subunit beta
orb1631287-02 100 µg

Recombinant Calloselasma rhodostoma Snaclec rhodocytin subunit beta

Sign In for Pricing
View Details
Recombinant Calloselasma rhodostoma Snaclec rhodocytin subunit beta
orb1631287-03 1 mg

Recombinant Calloselasma rhodostoma Snaclec rhodocytin subunit beta

Sign In for Pricing
View Details
Recombinant Acidithiobacillus ferrooxidans ATP synthase subunit b (atpF)
orb2903062-01 20 µg

Recombinant Acidithiobacillus ferrooxidans ATP synthase subunit b (atpF)

Sign In for Pricing
View Details
Recombinant Acidithiobacillus ferrooxidans ATP synthase subunit b (atpF)
orb2903062-02 100 µg

Recombinant Acidithiobacillus ferrooxidans ATP synthase subunit b (atpF)

Sign In for Pricing
View Details