Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CUX1 Rabbit Polyclonal Antibody (FITC)

CUX1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

CDP, CUX, p75, CASP, CDP1, COY1, Clox, GDDI, p100, p110, p200, CUTL1, GOLIM6, CDP/Cut, Cux/CDP, Nbla10317

UniProt

Q13948

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human CUX1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: VKNQEVTIKALKEKIREYEQTLKNQAETIALEKEQKLQNDFAEKERKLQE

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

77kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001904

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human MICAL3 activation kit by CRISPRa
GA111583 1 Kit

Human MICAL3 activation kit by CRISPRa

Sign In for Pricing
View Details
ELP3 (NM_018091) Human Over-expression Lysate
LY402648 100 µg

ELP3 (NM_018091) Human Over-expression Lysate

Sign In for Pricing
View Details
FGF21 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1H4]
TA502953AM 100 µL

FGF21 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1H4]

Sign In for Pricing
View Details
Eotaxin 3 (CCL26) (NM_006072) Human Over-expression Lysate
LY401828 100 µg

Eotaxin 3 (CCL26) (NM_006072) Human Over-expression Lysate

Sign In for Pricing
View Details
MART-1 / Melan-A (MLANA/788), Biotin conjugate, 0.1mg/mL
BNCB0788-100 1x 100 µL

MART-1 / Melan-A (MLANA/788), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SFTA3 (NM_001101341) Human Over-expression Lysate
LC426141 20 µg

SFTA3 (NM_001101341) Human Over-expression Lysate

Sign In for Pricing
View Details