Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rnf13 Rabbit Polyclonal Antibody (FITC)

Rnf13 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Rz, Rzf, 2010001H16Rik

UniProt

Q3UTG4

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Rnf13

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: IGESSANSLKDEFTYEKGGHIILVPELSLPLEYYLIPFLIIVGICLILIV

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_036013

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DIABLO (NM_019887) Human Tagged Lenti ORF Clone
RC204077L2 10 µg

DIABLO (NM_019887) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
RHOXF2B (NM_001099685) Human Tagged ORF Clone Lentiviral Particle
RC213308L4V 200 µL

RHOXF2B (NM_001099685) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Akt1, phosphorylated (Ser473) (Rac PKa, PKBa) (MaxLight 550)
A1125-03-ML550 100 µL

Akt1, phosphorylated (Ser473) (Rac PKa, PKBa) (MaxLight 550)

Sign In for Pricing
View Details
Terminal Complement Complex C5b-9 (C5b-9) Rat ELISA Kit
H5120 96 Tests

Terminal Complement Complex C5b-9 (C5b-9) Rat ELISA Kit

Sign In for Pricing
View Details
Recombinant Mouse CTLA-4/CD152 Protein, His Tag
E40KMP2191 20 µg

Recombinant Mouse CTLA-4/CD152 Protein, His Tag

Sign In for Pricing
View Details
KDM5A Recombinant Antibody, Biotin Conjugated
bsm-61779R-Biotin-01 20 µL

KDM5A Recombinant Antibody, Biotin Conjugated

Sign In for Pricing
View Details