Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rnf13 Rabbit Polyclonal Antibody (FITC)

Rnf13 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Rz, Rzf, 2010001H16Rik

UniProt

Q3UTG4

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Rnf13

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: IGESSANSLKDEFTYEKGGHIILVPELSLPLEYYLIPFLIIVGICLILIV

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_036013

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DKC1 (Dyskeratosis Congenita 1, Dyskerin, CBF5, DKC, FLJ97620, NAP57, NOLA4, XAP101) (FITC)
245349-FITC 100 µL

DKC1 (Dyskeratosis Congenita 1, Dyskerin, CBF5, DKC, FLJ97620, NAP57, NOLA4, XAP101) (FITC)

Sign In for Pricing
View Details
HES1 (Hairy Family Helix-loop-helix Transcription Factor) (MaxLight 750) discontinued
H2034-35-ML750 100 µL

HES1 (Hairy Family Helix-loop-helix Transcription Factor) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Moxalactam Sodium Salt (LTX) extrapure, 85%
77810-01 100 mg

Moxalactam Sodium Salt (LTX) extrapure, 85%

Sign In for Pricing
View Details
Moxalactam Sodium Salt (LTX) extrapure, 85%
77810-02 1 g

Moxalactam Sodium Salt (LTX) extrapure, 85%

Sign In for Pricing
View Details
TIE2 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
bs-1300R-BF594-01 20 µL

TIE2 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
TIE2 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
bs-1300R-BF594-02 100 µL

TIE2 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details