Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Atf2 Rabbit Polyclonal Antibody (FITC)

Atf2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

Q00969

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Rat

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: TPTPTRFLKNCEEVGLFNELASPFENEFKKASEDDIKKMPLDLSPLATPI

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

52kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_112280

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human ESYT2 sgRNA gene knockout kit - Lentiviral human ESYT2 sgRNA gene knockout kit (25)
GTR15360084 1 Vial

Lentiviral human ESYT2 sgRNA gene knockout kit - Lentiviral human ESYT2 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
Proprotein Convertase Subtilisin/Kexin Type 6 (PCSK6) Magnetic Fluorescence Assay Kit
MBS2159701-01 96 Tests

Proprotein Convertase Subtilisin/Kexin Type 6 (PCSK6) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Proprotein Convertase Subtilisin/Kexin Type 6 (PCSK6) Magnetic Fluorescence Assay Kit
MBS2159701-02 5x 96 Tests

Proprotein Convertase Subtilisin/Kexin Type 6 (PCSK6) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Proprotein Convertase Subtilisin/Kexin Type 6 (PCSK6) Magnetic Fluorescence Assay Kit
MBS2159701-03 10x 96 Tests

Proprotein Convertase Subtilisin/Kexin Type 6 (PCSK6) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Lentiviral mouse Smad2 shRNA (UAS) - Lentiviral mouse Smad2 shRNA (UAS) plasmid
GTR15263311 1 Vial

Lentiviral mouse Smad2 shRNA (UAS) - Lentiviral mouse Smad2 shRNA (UAS) plasmid

Sign In for Pricing
View Details
Neprilysin Antibody / CD10
V9679SAF-100UG 100 µg

Neprilysin Antibody / CD10

Sign In for Pricing
View Details