Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAZ Rabbit Polyclonal Antibody (HRP)

MAZ Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PUR1, ZF87, Pur-1, SAF-1, SAF-2, SAF-3, Zif87, ZNF801

UniProt

P56270

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human MAZ

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ALEKKTKSKGPYICALCAKEFKNGYNLRRHEAIHTGAKAGRVPSGAMKMP

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

48kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_002374

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Trem2 shRNA (UAS) - Lentiviral mouse Trem2 shRNA (UAS) plasmid
GTR15238567 1 Vial

Lentiviral mouse Trem2 shRNA (UAS) - Lentiviral mouse Trem2 shRNA (UAS) plasmid

Sign In for Pricing
View Details
Dopamine Receptor D1 (DRD1) BioAssayTM ELISA Kit (Mouse)
589221 96 Tests

Dopamine Receptor D1 (DRD1) BioAssayTM ELISA Kit (Mouse)

Sign In for Pricing
View Details
Phosphonic acid silica, 0.8 - 1.2 mmol/g - Metal Scavengers
SIV0003-01 10 g

Phosphonic acid silica, 0.8 - 1.2 mmol/g - Metal Scavengers

Sign In for Pricing
View Details
Phosphonic acid silica, 0.8 - 1.2 mmol/g - Metal Scavengers
SIV0003-02 25 g

Phosphonic acid silica, 0.8 - 1.2 mmol/g - Metal Scavengers

Sign In for Pricing
View Details
Phosphonic acid silica, 0.8 - 1.2 mmol/g - Metal Scavengers
SIV0003-03 50 g

Phosphonic acid silica, 0.8 - 1.2 mmol/g - Metal Scavengers

Sign In for Pricing
View Details
Phosphonic acid silica, 0.8 - 1.2 mmol/g - Metal Scavengers
SIV0003-04 100 g

Phosphonic acid silica, 0.8 - 1.2 mmol/g - Metal Scavengers

Sign In for Pricing
View Details