Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SIAH1 Rabbit Polyclonal Antibody (FITC)

SIAH1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

SIAH1A

UniProt

Q8IUQ4

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SIAH1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: FTCLPAARTRKRKEMSRQTATALPTGTSKCPPSQRVPALTGTTASNNDLA

Field of Research

Cell Biology

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_001006611

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Escherichia coli O81 (strain ED1a) prfC Polyclonal Antibody
MBS7177163 Inquire

Rabbit anti-Escherichia coli O81 (strain ED1a) prfC Polyclonal Antibody

Sign In for Pricing
View Details
DUSP3, NT (Dual Specificity Protein Phosphatase 3, Dual Specificity Protein Phosphatase VHR, VHR) (AP) discontinued
D9840-06C-AP 200 µL

DUSP3, NT (Dual Specificity Protein Phosphatase 3, Dual Specificity Protein Phosphatase VHR, VHR) (AP) discontinued

Sign In for Pricing
View Details
Hsa-miR-7706 miRNA Mimic
CMH2504-01 5 nmol

Hsa-miR-7706 miRNA Mimic

Sign In for Pricing
View Details
Hsa-miR-7706 miRNA Mimic
CMH2504-02 10 nmol

Hsa-miR-7706 miRNA Mimic

Sign In for Pricing
View Details
ITPK1 (Inositol-tetrakisphosphate 1-kinase, Inositol 1,3,4-trisphosphate 5/6-kinase, Ins (1,3,4) P (3) 5/6-kinase) APC
MBS6137234-01 0.1 mL

ITPK1 (Inositol-tetrakisphosphate 1-kinase, Inositol 1,3,4-trisphosphate 5/6-kinase, Ins (1,3,4) P (3) 5/6-kinase) APC

Sign In for Pricing
View Details
ITPK1 (Inositol-tetrakisphosphate 1-kinase, Inositol 1,3,4-trisphosphate 5/6-kinase, Ins (1,3,4) P (3) 5/6-kinase) APC
MBS6137234-02 5x 0.1 mL

ITPK1 (Inositol-tetrakisphosphate 1-kinase, Inositol 1,3,4-trisphosphate 5/6-kinase, Ins (1,3,4) P (3) 5/6-kinase) APC

Sign In for Pricing
View Details