Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SMARCA2 Rabbit Polyclonal Antibody (HRP)

SMARCA2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

BRM, SNF2, SWI2, hBRM, NCBRS, Sth1p, BAF190, SNF2L2, SNF2LA, hSNF2a

UniProt

P51531

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human SMARCA2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EKVPSNSQLEIEGNSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIK

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

27kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001276325.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human hsa-miR-650 miRNA Agomir
abx880426-01 5 nmol

Human hsa-miR-650 miRNA Agomir

Sign In for Pricing
View Details
Human hsa-miR-650 miRNA Agomir
abx880426-02 10 nmol

Human hsa-miR-650 miRNA Agomir

Sign In for Pricing
View Details
Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) TY2B-LR2 Polyclonal Antibody
MBS7150658 Inquire

Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) TY2B-LR2 Polyclonal Antibody

Sign In for Pricing
View Details
Porcine Epididymal Secretory Glutathione Peroxidase (GPX5) ELISA Kit
MBS109276-01 48 Well

Porcine Epididymal Secretory Glutathione Peroxidase (GPX5) ELISA Kit

Sign In for Pricing
View Details
Porcine Epididymal Secretory Glutathione Peroxidase (GPX5) ELISA Kit
MBS109276-02 96 Well

Porcine Epididymal Secretory Glutathione Peroxidase (GPX5) ELISA Kit

Sign In for Pricing
View Details
Porcine Epididymal Secretory Glutathione Peroxidase (GPX5) ELISA Kit
MBS109276-03 5x 96 Well

Porcine Epididymal Secretory Glutathione Peroxidase (GPX5) ELISA Kit

Sign In for Pricing
View Details