Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SMARCB1 Rabbit Polyclonal Antibody (FITC)

SMARCB1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

RDT, CSS3, INI1, SNF5, Snr1, BAF47, MRD15, RTPS1, Sfh1p, hSNFS, SNF5L1, SWNTS1, PPP1R144

UniProt

Q12824

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SMARCB1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: RGSLYKRYPSLWRRLATVEERKKIVASSHGKKTKPNTKDHGYTTLATSVT

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

44kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_003064

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

CKMT1A, NT (Creatine Kinase U-type, Mitochondrial, Ubiquitous Mitochondrial Creatine Kinase, U-MtCK, Acidic-type Mitochondrial Creatine Kinase, Mia-CK, CKMT1A, CKMT, CKMT1B, CKMT)
C7910-20A 200 µL

CKMT1A, NT (Creatine Kinase U-type, Mitochondrial, Ubiquitous Mitochondrial Creatine Kinase, U-MtCK, Acidic-type Mitochondrial Creatine Kinase, Mia-CK, CKMT1A, CKMT, CKMT1B, CKMT)

Sign In for Pricing
View Details
CHIC2 Antibody - N-terminal region : FITC (ARP46856_P050-FITC)
ARP46856_P050-FITC 100 µL

CHIC2 Antibody - N-terminal region : FITC (ARP46856_P050-FITC)

Sign In for Pricing
View Details
TRPV1 discontinued
395744 200 µL

TRPV1 discontinued

Sign In for Pricing
View Details
Vom1r49 (NM_001008920) Rat Tagged ORF Clone
RR202114 10 µg

Vom1r49 (NM_001008920) Rat Tagged ORF Clone

Sign In for Pricing
View Details
Olr505 Rat siRNA Oligo Duplex (Locus ID 404882)
SR510039 1 Kit

Olr505 Rat siRNA Oligo Duplex (Locus ID 404882)

Sign In for Pricing
View Details
MGS1 Antibody
orb852610 2 mg

MGS1 Antibody

Sign In for Pricing
View Details