Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRIM26 Rabbit Polyclonal Antibody (FITC)

TRIM26 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

AFP, RNF95, ZNF173

UniProt

Q12899

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TRIM26

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: KKLQDQRQYIVAEFEQGHQFLREREEHLLEQLAKLEQELTEGREKFKSRG

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

62kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_003440

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RBPJK (RBPJ) Rabbit Polyclonal Antibody
TA324617 400 µL

RBPJK (RBPJ) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Anti-ICT1 (MRPL58) Mouse Monoclonal Antibody [Clone ID: OTI2F9]
M31846 100 µL

Anti-ICT1 (MRPL58) Mouse Monoclonal Antibody [Clone ID: OTI2F9]

Sign In for Pricing
View Details
Anti-INPP5D Antibody Picoband® Fluoro550 Conjugated
A03358-1-Fluoro550 100 µg/Vial

Anti-INPP5D Antibody Picoband® Fluoro550 Conjugated

Sign In for Pricing
View Details
HRP-Linked Monoclonal Antibody to Cytotoxic T-Lymphocyte Associated Antigen 4 (CTLA4)
MBS2141525-01 0.1 mL

HRP-Linked Monoclonal Antibody to Cytotoxic T-Lymphocyte Associated Antigen 4 (CTLA4)

Sign In for Pricing
View Details
HRP-Linked Monoclonal Antibody to Cytotoxic T-Lymphocyte Associated Antigen 4 (CTLA4)
MBS2141525-02 0.2 mL

HRP-Linked Monoclonal Antibody to Cytotoxic T-Lymphocyte Associated Antigen 4 (CTLA4)

Sign In for Pricing
View Details
HRP-Linked Monoclonal Antibody to Cytotoxic T-Lymphocyte Associated Antigen 4 (CTLA4)
MBS2141525-03 0.5 mL

HRP-Linked Monoclonal Antibody to Cytotoxic T-Lymphocyte Associated Antigen 4 (CTLA4)

Sign In for Pricing
View Details