Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRIM26 Rabbit Polyclonal Antibody (HRP)

TRIM26 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

AFP, RNF95, ZNF173

UniProt

Q12899

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TRIM26

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KKLQDQRQYIVAEFEQGHQFLREREEHLLEQLAKLEQELTEGREKFKSRG

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

62kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_003440

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPR54 Antibody
MBS9604265-01 0.1 mL

GPR54 Antibody

Sign In for Pricing
View Details
GPR54 Antibody
MBS9604265-02 0.2 mL

GPR54 Antibody

Sign In for Pricing
View Details
GPR54 Antibody
MBS9604265-03 5x 0.2 mL

GPR54 Antibody

Sign In for Pricing
View Details
CD11d (CD11 Antigen-like Family Member D, ADB2, Integrin alpha D, FLJ39841, Leukointegrin alpha D) discontinued
C2262-75A 2 mL

CD11d (CD11 Antigen-like Family Member D, ADB2, Integrin alpha D, FLJ39841, Leukointegrin alpha D) discontinued

Sign In for Pricing
View Details
RT1-Da Protein Vector (Rat) (pPB-N-His)
PV302815 500 ng

RT1-Da Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
PABPC1 (Methyl-Arg455/460) Antibody Blocking Peptide
orb1504740 500 µg

PABPC1 (Methyl-Arg455/460) Antibody Blocking Peptide

Sign In for Pricing
View Details