Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRIM26 Rabbit Polyclonal Antibody (Biotin)

TRIM26 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

AFP, RNF95, ZNF173

UniProt

A2AE48

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human TRIM26

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: NHLSTLRRDRDKIQGFQAKGEADILAALKKLQDQRQYIVAEFEQGHQFLR

Field of Research

Immunology & Inflammation

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

27kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

CAM25547

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KRT15 Antibody
orb3160377-01 50 µL

KRT15 Antibody

Sign In for Pricing
View Details
KRT15 Antibody
orb3160377-02 100 µL

KRT15 Antibody

Sign In for Pricing
View Details
FCER2 Antibody, HRP conjugated
CSB-PA02219B0Rb-01 50 µg

FCER2 Antibody, HRP conjugated

Sign In for Pricing
View Details
FCER2 Antibody, HRP conjugated
CSB-PA02219B0Rb-02 100 µg

FCER2 Antibody, HRP conjugated

Sign In for Pricing
View Details
Human Complement fragment 3c, C3c ELISA Kit
MBS705220-01 24 Well (LIMIT 1)

Human Complement fragment 3c, C3c ELISA Kit

Sign In for Pricing
View Details
Human Complement fragment 3c, C3c ELISA Kit
MBS705220-02 48 Well

Human Complement fragment 3c, C3c ELISA Kit

Sign In for Pricing
View Details