Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ENC1 Rabbit Polyclonal Antibody (Biotin)

ENC1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

NRPB, CCL28, ENC-1, PIG10, KLHL35, KLHL37, TP53I10

UniProt

O14682

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ENC1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MSVSVHENRKSRASSGSINIYLFHKSSYADSVLTHLNLLRQQRLFTDVLL

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

66kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_003624

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Clostridium Kluyveri accD Protein (aa 1-291) (strain NBRC 12016)
VAng-Lsx9389-500gEcoli 500 µg (E. coli)

Recombinant Clostridium Kluyveri accD Protein (aa 1-291) (strain NBRC 12016)

Sign In for Pricing
View Details
Canine Zinc finger protein 700 (ZNF700) ELISA Kit
EIA07462Ca 1 Kit

Canine Zinc finger protein 700 (ZNF700) ELISA Kit

Sign In for Pricing
View Details
LentimiRa-hsa-miR-203b-3p Vector
mh41666 500 ng

LentimiRa-hsa-miR-203b-3p Vector

Sign In for Pricing
View Details
LIFR Rabbit Polyclonal Antibody (PE)
orb2436785 100 µL

LIFR Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
HSP60 (Heat Shock Protein 60, 60kD chaperonin, 60kD heat shock Protein mitochondrial, Chaperonin, 60-KD, CPN60, GROEL, HLD4, HSP65, HSPD1, HuCHA60, Mitochondrial matrix Protein P1, P60 lymphocyte Protein, Short heat shock Protein 60 Hsp60s1, Spastic paraplegia 13, SPG13) (BSA & Azide Free) (MaxLight 490)
172109-AF-ML490 100 µL

HSP60 (Heat Shock Protein 60, 60kD chaperonin, 60kD heat shock Protein mitochondrial, Chaperonin, 60-KD, CPN60, GROEL, HLD4, HSP65, HSPD1, HuCHA60, Mitochondrial matrix Protein P1, P60 lymphocyte Protein, Short heat shock Protein 60 Hsp60s1, Spastic paraplegia 13, SPG13) (BSA & Azide Free) (MaxLight 490)

Sign In for Pricing
View Details
Rfx8 (NM_001145660) Mouse Tagged ORF Clone
MR222428 10 µg

Rfx8 (NM_001145660) Mouse Tagged ORF Clone

Sign In for Pricing
View Details