Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ENC1 Rabbit Polyclonal Antibody (Biotin)

ENC1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

NRPB, CCL28, ENC-1, PIG10, KLHL35, KLHL37, TP53I10

UniProt

O14682

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ENC1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MSVSVHENRKSRASSGSINIYLFHKSSYADSVLTHLNLLRQQRLFTDVLL

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

66kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_003624

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Staphylococcus carnosus (strain TM300) rpsI Polyclonal Antibody
MBS7158906 Inquire

Rabbit anti-Staphylococcus carnosus (strain TM300) rpsI Polyclonal Antibody

Sign In for Pricing
View Details
Anti-HSPB1-associated protein 1 HSPBAP1 Antibody
A13002-2 100 µL

Anti-HSPB1-associated protein 1 HSPBAP1 Antibody

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Kallikrein 6 (KLK6)
MBS2046111-01 0.1 mL

PE-Linked Polyclonal Antibody to Kallikrein 6 (KLK6)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Kallikrein 6 (KLK6)
MBS2046111-02 0.2 mL

PE-Linked Polyclonal Antibody to Kallikrein 6 (KLK6)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Kallikrein 6 (KLK6)
MBS2046111-03 0.5 mL

PE-Linked Polyclonal Antibody to Kallikrein 6 (KLK6)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Kallikrein 6 (KLK6)
MBS2046111-04 1 mL

PE-Linked Polyclonal Antibody to Kallikrein 6 (KLK6)

Sign In for Pricing
View Details