Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ASH2L Rabbit Polyclonal Antibody (HRP)

ASH2L Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ASH2, Bre2, ASH2L1, ASH2L2

UniProt

Q9UBL3

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ASH2L

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: AAGSSGKGRGAKRKQQDGGTTGTTKKARSDPLFSAQRLPPHGYPLEHPFN

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

69kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_004665

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD11b (Cell Surface Glycoprotein MAC1 Alpha Subunit, Complement Component Receptor 3 Alpha, CR3A, ITGAM, MAC1A, MO1A, Neutrophil Adherence Receptor) (FITC)
MBS6249485-01 0.1 mL

CD11b (Cell Surface Glycoprotein MAC1 Alpha Subunit, Complement Component Receptor 3 Alpha, CR3A, ITGAM, MAC1A, MO1A, Neutrophil Adherence Receptor) (FITC)

Sign In for Pricing
View Details
CD11b (Cell Surface Glycoprotein MAC1 Alpha Subunit, Complement Component Receptor 3 Alpha, CR3A, ITGAM, MAC1A, MO1A, Neutrophil Adherence Receptor) (FITC)
MBS6249485-02 5x 0.1 mL

CD11b (Cell Surface Glycoprotein MAC1 Alpha Subunit, Complement Component Receptor 3 Alpha, CR3A, ITGAM, MAC1A, MO1A, Neutrophil Adherence Receptor) (FITC)

Sign In for Pricing
View Details
C11orf42 CRISPR Activation Plasmid (h2)
sc-414813-ACT-2 20 µg

C11orf42 CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details
PHBP15 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV740253 1.0 µg DNA

PHBP15 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
HNF1α Rabbit mAb
C05843-01 20 µL

HNF1α Rabbit mAb

Sign In for Pricing
View Details
HNF1α Rabbit mAb
C05843-02 100 µL

HNF1α Rabbit mAb

Sign In for Pricing
View Details