Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ASH2L Rabbit Polyclonal Antibody (FITC)

ASH2L Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

ASH2, Bre2, ASH2L1, ASH2L2

UniProt

Q9UBL3

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ASH2L

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: EPSSGEAEGGEANLVDVSGGLETESSNGKDTLEGAGDTSEVMDTQAGSVD

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

69kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_004665

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human HOXC9 Protein, N-His-KSI
orb3149498-01 50 µg

Recombinant Human HOXC9 Protein, N-His-KSI

Sign In for Pricing
View Details
Recombinant Human HOXC9 Protein, N-His-KSI
orb3149498-02 100 µg

Recombinant Human HOXC9 Protein, N-His-KSI

Sign In for Pricing
View Details
Recombinant Human HOXC9 Protein, N-His-KSI
orb3149498-03 1 mg

Recombinant Human HOXC9 Protein, N-His-KSI

Sign In for Pricing
View Details
HCG-intact (HCGab/52), CF488A conjugate, 0.1mg/mL
BNC880052-500 1x 500 µL

HCG-intact (HCGab/52), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Streptococcus equi subsp. zooepidemicus Tyrosine recombinase XerS (xerS)
MBS1099788-01 0.02 mg (E-Coli)

Recombinant Streptococcus equi subsp. zooepidemicus Tyrosine recombinase XerS (xerS)

Sign In for Pricing
View Details
Recombinant Streptococcus equi subsp. zooepidemicus Tyrosine recombinase XerS (xerS)
MBS1099788-02 0.02 mg (Yeast)

Recombinant Streptococcus equi subsp. zooepidemicus Tyrosine recombinase XerS (xerS)

Sign In for Pricing
View Details