Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DXYS155E Rabbit Polyclonal Antibody (Biotin)

DXYS155E Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

XE7, 721P, XE7Y, CCDC133, CXYorf3, PRKA17A, SFRS17A, AKAP-17A, DXYS155E

UniProt

Q8N6U9

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human DXYS155E

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: NWEVMERLKGMVQNHQFSTLRISKSTMDFIRFEGEVENKSLVKSFLACLD

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

81kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Human, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_005079

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Thyroglobulin Rabbit mAb IHC Kit
KM3838-01 3 mL

Thyroglobulin Rabbit mAb IHC Kit

Sign In for Pricing
View Details
Thyroglobulin Rabbit mAb IHC Kit
KM3838-02 6 mL

Thyroglobulin Rabbit mAb IHC Kit

Sign In for Pricing
View Details
Thyroglobulin Rabbit mAb IHC Kit
KM3838-03 10 mL

Thyroglobulin Rabbit mAb IHC Kit

Sign In for Pricing
View Details
Chicken RPA1/Replication protein A 70 kDa DNA-binding subunit ELISA Kit
MBS2904203-01 48 Well

Chicken RPA1/Replication protein A 70 kDa DNA-binding subunit ELISA Kit

Sign In for Pricing
View Details
Chicken RPA1/Replication protein A 70 kDa DNA-binding subunit ELISA Kit
MBS2904203-02 96 Well

Chicken RPA1/Replication protein A 70 kDa DNA-binding subunit ELISA Kit

Sign In for Pricing
View Details
Chicken RPA1/Replication protein A 70 kDa DNA-binding subunit ELISA Kit
MBS2904203-03 5x 96 Well

Chicken RPA1/Replication protein A 70 kDa DNA-binding subunit ELISA Kit

Sign In for Pricing
View Details