Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PCGF4 Rabbit Polyclonal Antibody (FITC)

PCGF4 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

PCGF4, RNF51, FLVI2/BMI1, flvi-2/bmi-1

UniProt

P35226

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human PCGF4

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: TPVQSPHPQFPHISSTMNGTSNSPSGNHQSSFANRPRKSSVNGSSATSSG

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_005171

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Syndecan 4 (SDC4) ELISA Kit
YLA4351HU-01 48 Tests

Human Syndecan 4 (SDC4) ELISA Kit

Sign In for Pricing
View Details
Human Syndecan 4 (SDC4) ELISA Kit
YLA4351HU-02 96 Tests

Human Syndecan 4 (SDC4) ELISA Kit

Sign In for Pricing
View Details
Poliovirus Receptor Human Recombinant
rAP-4342 1 Each

Poliovirus Receptor Human Recombinant

Sign In for Pricing
View Details
CBP (CREB Binding Protein, CREBBP, KAT3A, Rubinstein-Taybi Syndrome, RSTS, RTS) (MaxLight 405) discontinued
C2098-03B-ML405 100 µL

CBP (CREB Binding Protein, CREBBP, KAT3A, Rubinstein-Taybi Syndrome, RSTS, RTS) (MaxLight 405) discontinued

Sign In for Pricing
View Details
ZNRF1 Human qPCR Template Standard (NM_032268)
HK208213 1 Kit

ZNRF1 Human qPCR Template Standard (NM_032268)

Sign In for Pricing
View Details
Porcine C1q-related factor (C1QL1) ELISA Kit
MBS7249030-01 48 Well

Porcine C1q-related factor (C1QL1) ELISA Kit

Sign In for Pricing
View Details