Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PCGF4 Rabbit Polyclonal Antibody (HRP)

PCGF4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PCGF4, RNF51, FLVI2/BMI1, flvi-2/bmi-1

UniProt

P35226

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human PCGF4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TPVQSPHPQFPHISSTMNGTSNSPSGNHQSSFANRPRKSSVNGSSATSSG

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_005171

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4,5-Dichloro-2- (2-methoxyethoxy) phenylboronic acid
433659-01 25 mg

4,5-Dichloro-2- (2-methoxyethoxy) phenylboronic acid

Sign In for Pricing
View Details
4,5-Dichloro-2- (2-methoxyethoxy) phenylboronic acid
433659-02 50 mg

4,5-Dichloro-2- (2-methoxyethoxy) phenylboronic acid

Sign In for Pricing
View Details
Factor I light chain Rabbit Polyclonal Antibody (PerCP)
orb2441045 100 µL

Factor I light chain Rabbit Polyclonal Antibody (PerCP)

Sign In for Pricing
View Details
WNK2 Lentiviral Activation Particles (m2)
sc-429142-LAC-2 200 µL

WNK2 Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details
ENT1 Antibody Blocking peptide
orb1459862 500 µg

ENT1 Antibody Blocking peptide

Sign In for Pricing
View Details
DAZAP1 Double Nickase Plasmid (m)
sc-427652-NIC 20 µg

DAZAP1 Double Nickase Plasmid (m)

Sign In for Pricing
View Details