Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MED6 Rabbit Polyclonal Antibody (HRP)

MED6 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ARC33, NY-REN-28

UniProt

O75586

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human MED6

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LLLDLRQKFPPKFVQLKPGEKPVPVDQTKKEAEPIPETVKPEEKETTKNV

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

ChIP, WB

NCBI Accession Number

NP_005457

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Anti Ganglioside M1 Antibody ELISA kit
GTR10423215 96 Well

Mouse Anti Ganglioside M1 Antibody ELISA kit

Sign In for Pricing
View Details
Mouse Poly ADP Ribose Polymerase 1 (PARP1) ELISA Kit
abx576739-01 96 Tests

Mouse Poly ADP Ribose Polymerase 1 (PARP1) ELISA Kit

Sign In for Pricing
View Details
Mouse Poly ADP Ribose Polymerase 1 (PARP1) ELISA Kit
abx576739-02 5x 96 Tests

Mouse Poly ADP Ribose Polymerase 1 (PARP1) ELISA Kit

Sign In for Pricing
View Details
Mouse Poly ADP Ribose Polymerase 1 (PARP1) ELISA Kit
abx576739-03 10x 96 Tests

Mouse Poly ADP Ribose Polymerase 1 (PARP1) ELISA Kit

Sign In for Pricing
View Details
FKBP14 Protein, Human, Recombinant (His Tag)
MBS8121449-01 0.1 mg

FKBP14 Protein, Human, Recombinant (His Tag)

Sign In for Pricing
View Details
FKBP14 Protein, Human, Recombinant (His Tag)
MBS8121449-02 5x 0.1 mg

FKBP14 Protein, Human, Recombinant (His Tag)

Sign In for Pricing
View Details