Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CXORF6 Rabbit Polyclonal Antibody (HRP)

CXORF6 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CG1, F18, HYSP2, CXorf6

UniProt

Q13495

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human CXORF6

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LEELTKIQDPSPNELDLEKILGTKPEEPLVLDHPQATLSTTPKPSVQMSH

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

74kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_005482

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Liver
CR561415 5 µg

Tissue Total RNA, Liver

Sign In for Pricing
View Details
Spermidine or Spermine N1-Acetyltransferase 1 (CPTC-SAT1-3), CF640R conjugate, 0.1mg/mL
BNC402273-100 1x 100 µL

Spermidine or Spermine N1-Acetyltransferase 1 (CPTC-SAT1-3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IRAK2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2B7]
TA803677AM 100 µL

IRAK2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2B7]

Sign In for Pricing
View Details
VKORC1 (NM_206824) Human Recombinant Protein
TP314831L 1 mg

VKORC1 (NM_206824) Human Recombinant Protein

Sign In for Pricing
View Details
Sprouty 4 (SPRY4) Human Gene Knockout Kit (CRISPR)
KN424581 1 Kit

Sprouty 4 (SPRY4) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
2-Amino-4-thiazoleglyoxylic Acid
TRC-A630205-1G 1 g

2-Amino-4-thiazoleglyoxylic Acid

Sign In for Pricing
View Details