Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CXORF6 Rabbit Polyclonal Antibody (Biotin)

CXORF6 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CG1, F18, HYSP2, CXorf6

UniProt

Q13495

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human CXORF6

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LEELTKIQDPSPNELDLEKILGTKPEEPLVLDHPQATLSTTPKPSVQMSH

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

74kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_005482

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human TraB domain containing (TRABD) activation kit by CRISPRa
GA112907 1 Kit

Human TraB domain containing (TRABD) activation kit by CRISPRa

Sign In for Pricing
View Details
SMAD6 (NM_001142861) Human Over-expression Lysate
LY428291 100 µg

SMAD6 (NM_001142861) Human Over-expression Lysate

Sign In for Pricing
View Details
Vertical Laminar Airflow BLVR-302
BLVR-302 1 Unit

Vertical Laminar Airflow BLVR-302

Sign In for Pricing
View Details
UBE2U antibody
FNab09186 100 µg

UBE2U antibody

Sign In for Pricing
View Details
Occludin (Marker of Early Blood Brain Barrier Damage) (OCLN/2181), CF594 conjugate, 0.1mg/mL
BNC942181-100 1x 100 µL

Occludin (Marker of Early Blood Brain Barrier Damage) (OCLN/2181), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tryptophan Hydroxylase 1 (TPH1) Recombinant Rabbit monoclonal Antibody
HA750214 100 µL

Tryptophan Hydroxylase 1 (TPH1) Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details