Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AFDN Rabbit Polyclonal Antibody (HRP)

AFDN Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

AF6, MLLT4, MLL-AF6, l-afadin

UniProt

P55196

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human MLLT4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GVIQNFKRTLSKKEKKEKKKREKEALRQASDKDDRPFQGEDVENSRLAAE

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

74kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

EAW47480

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chicken Acidic mammalian chitinase (CHIA) ELISA Kit
MBS7221884-01 48 Well

Chicken Acidic mammalian chitinase (CHIA) ELISA Kit

Sign In for Pricing
View Details
Chicken Acidic mammalian chitinase (CHIA) ELISA Kit
MBS7221884-02 96 Well

Chicken Acidic mammalian chitinase (CHIA) ELISA Kit

Sign In for Pricing
View Details
Chicken Acidic mammalian chitinase (CHIA) ELISA Kit
MBS7221884-03 5x 96 Well

Chicken Acidic mammalian chitinase (CHIA) ELISA Kit

Sign In for Pricing
View Details
Chicken Acidic mammalian chitinase (CHIA) ELISA Kit
MBS7221884-04 10x 96 Well

Chicken Acidic mammalian chitinase (CHIA) ELISA Kit

Sign In for Pricing
View Details
Carcinoembryonic Antigen-Related Cell Adhesion Molecule 5 (CEACAM5) Antibody
abx019297 1 mg

Carcinoembryonic Antigen-Related Cell Adhesion Molecule 5 (CEACAM5) Antibody

Sign In for Pricing
View Details
TRPC5, NT (TRPC5, TRP5, Short transient receptor potential channel 5, Transient receptor protein 5) (FITC)
MBS6358839-01 0.2 mL

TRPC5, NT (TRPC5, TRP5, Short transient receptor potential channel 5, Transient receptor protein 5) (FITC)

Sign In for Pricing
View Details