Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AFDN Rabbit Polyclonal Antibody (Biotin)

AFDN Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

AF6, MLLT4, MLL-AF6, l-afadin

UniProt

P55196

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human MLLT4

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: GVIQNFKRTLSKKEKKEKKKREKEALRQASDKDDRPFQGEDVENSRLAAE

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

74kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

EAW47480

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse NDUFC2 shRNA Plasmid
abx976530-01 150 µg

Mouse NDUFC2 shRNA Plasmid

Sign In for Pricing
View Details
Mouse NDUFC2 shRNA Plasmid
abx976530-02 300 µg

Mouse NDUFC2 shRNA Plasmid

Sign In for Pricing
View Details
Rat CKLF (Chemokine Like Factor) CLIA Kit
MBS2531676-01 96 Tests

Rat CKLF (Chemokine Like Factor) CLIA Kit

Sign In for Pricing
View Details
Rat CKLF (Chemokine Like Factor) CLIA Kit
MBS2531676-02 5x 96 Tests

Rat CKLF (Chemokine Like Factor) CLIA Kit

Sign In for Pricing
View Details
Tecta AAV siRNA Pooled Vector
46475166 1.0 µg

Tecta AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Human IRF2 Recombinant Protein
PROTP14316-01 20 µg

Human IRF2 Recombinant Protein

Sign In for Pricing
View Details