Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PSMC2 Rabbit Polyclonal Antibody (FITC)

PSMC2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

S7, MSS1, RPT1, Nbla10058

UniProt

P35998

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PSMC2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MPDYLGADQRKTKEDEKDDKPIRALDEGDIALLKTYGQSTYSRQIKQVED

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

49kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_002794

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DUXA HDR Plasmid (h)
sc-417672-HDR 20 µg

DUXA HDR Plasmid (h)

Sign In for Pricing
View Details
Mouse Testis-expressed sequence 29 protein (TEX29) ELISA Kit
abx549365 96 Tests

Mouse Testis-expressed sequence 29 protein (TEX29) ELISA Kit

Sign In for Pricing
View Details
Rabbit Monoclonal RANK/TNFRSF11A Antibody (044) [Biotin]
NBP2-90884B 0.1 mL

Rabbit Monoclonal RANK/TNFRSF11A Antibody (044) [Biotin]

Sign In for Pricing
View Details
Recombinant Human Immunity-related GTPase family M protein
BP3234-50ug 50 µg

Recombinant Human Immunity-related GTPase family M protein

Sign In for Pricing
View Details
Mouse Monoclonal RanBP3 Antibody (12E11) [DyLight 405]
NBP2-42672V 100 µL

Mouse Monoclonal RanBP3 Antibody (12E11) [DyLight 405]

Sign In for Pricing
View Details
Mouse Monoclonal IL-12 R beta 1 Antibody (MM0363-7V24) [Alexa Fluor 594]
NBP2-11659AF594 0.1 mL

Mouse Monoclonal IL-12 R beta 1 Antibody (MM0363-7V24) [Alexa Fluor 594]

Sign In for Pricing
View Details