Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDC25A Rabbit Polyclonal Antibody (FITC)

CDC25A Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

CDC25A2

UniProt

P30304

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human CDC25A

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: QLQGLGSDYEQPLEVKNNSNLQRMGSSESTDSGFCLDSPGPLDSKENLEN

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

59 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001780

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SEMA7A (Semaphorin 7A) ValidElisa Kit
EK340552 96 Well

Human SEMA7A (Semaphorin 7A) ValidElisa Kit

Sign In for Pricing
View Details
OmniPAGE WAVE Maxi Comb, 5 sample, 1.5mm thick
VS20-5-1.5 1 Each

OmniPAGE WAVE Maxi Comb, 5 sample, 1.5mm thick

Sign In for Pricing
View Details
Porcine Olfactory receptor 8B2 (OR8B2) ELISA Kit
MBS7227979-01 48 Well

Porcine Olfactory receptor 8B2 (OR8B2) ELISA Kit

Sign In for Pricing
View Details
Porcine Olfactory receptor 8B2 (OR8B2) ELISA Kit
MBS7227979-02 96 Well

Porcine Olfactory receptor 8B2 (OR8B2) ELISA Kit

Sign In for Pricing
View Details
Porcine Olfactory receptor 8B2 (OR8B2) ELISA Kit
MBS7227979-03 5x 96 Well

Porcine Olfactory receptor 8B2 (OR8B2) ELISA Kit

Sign In for Pricing
View Details
Porcine Olfactory receptor 8B2 (OR8B2) ELISA Kit
MBS7227979-04 10x 96 Well

Porcine Olfactory receptor 8B2 (OR8B2) ELISA Kit

Sign In for Pricing
View Details