Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRIM9 Rabbit Polyclonal Antibody (HRP)

TRIM9 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RNF91, SPRING

UniProt

Q9C026

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TRIM9

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KDDKAWAMYVDNNRSWFMHNNSHTNRTEGGITKGATIGVLLDLNRKNLTF

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

79kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_055978

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Steroid 17-α-Hydroxylase/17 (20 lyase (CYP17A1) Chicken ELISA Kit
H3239 96 Tests

Steroid 17-α-Hydroxylase/17 (20 lyase (CYP17A1) Chicken ELISA Kit

Sign In for Pricing
View Details
1/2 wide x 500 Orange Tape
TAP1088 1 Each

1/2 wide x 500 Orange Tape

Sign In for Pricing
View Details
TRIM13, NT (TRIM13, LEU5, RFP2, RNF77, E3 ubiquitin-protein ligase TRIM13, B Cell chronic lymphocytic leukemia tumor suppressor Leu5, Leukemia-associated protein 5, Putative tumor suppressor RFP2, RING finger protein 77, Ret finger protein 2, Tripartite motif-containing protein 13) (MaxLight 750) discontinued
043214-ML750 100 µL

TRIM13, NT (TRIM13, LEU5, RFP2, RNF77, E3 ubiquitin-protein ligase TRIM13, B Cell chronic lymphocytic leukemia tumor suppressor Leu5, Leukemia-associated protein 5, Putative tumor suppressor RFP2, RING finger protein 77, Ret finger protein 2, Tripartite motif-containing protein 13) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Hsa-miR-1250-3p miRNA Mimic
orb1876658-01 5 nmol

Hsa-miR-1250-3p miRNA Mimic

Sign In for Pricing
View Details
Hsa-miR-1250-3p miRNA Mimic
orb1876658-02 10 nmol

Hsa-miR-1250-3p miRNA Mimic

Sign In for Pricing
View Details
LRRC39 Protein Vector (Rat) (pPM-C-HA)
PV280040 500 ng

LRRC39 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details