Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RNF113A Rabbit Polyclonal Antibody (FITC)

RNF113A Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

TTD5, Cwc24, RNF113, ZNF183

UniProt

O15541

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human RNF113A

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: VVRPEKKRVTHNPMIQKTRDSGKQKAAYGDLSSEEEEENEPESLGVVYKS

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_008909

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bsg (NM_009768) Mouse Tagged Lenti ORF Clone
MR225905L3 10 µg

Bsg (NM_009768) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Recombinant Human PRKCI Protein, N-His
E55P1729 50 µg

Recombinant Human PRKCI Protein, N-His

Sign In for Pricing
View Details
CEACAM20 Antibody
ABD13043 100 µg

CEACAM20 Antibody

Sign In for Pricing
View Details
Cylinder, Graduated, Globe Glass, 500mL
8330500 1 Each

Cylinder, Graduated, Globe Glass, 500mL

Sign In for Pricing
View Details
MBOAT7 (BB1, LENG4, OACT7, Lysophospholipid Acyltransferase 7, 1-acylglycerophosphatidylinositol O-Acyltransferase, Bladder and Breast Carcinoma-overexpressed Gene 1 Protein, Leukocyte Receptor Cluster Member 4, Lysophosphatidylinositol Acyltransferase, Membrane-bound O-acyltransferase Domain-containing Protein 7) (APC)
129060-APC 100 µL

MBOAT7 (BB1, LENG4, OACT7, Lysophospholipid Acyltransferase 7, 1-acylglycerophosphatidylinositol O-Acyltransferase, Bladder and Breast Carcinoma-overexpressed Gene 1 Protein, Leukocyte Receptor Cluster Member 4, Lysophosphatidylinositol Acyltransferase, Membrane-bound O-acyltransferase Domain-containing Protein 7) (APC)

Sign In for Pricing
View Details
Anti-TMEM88 Antibody Picoband®
A12951-1 100 µg/Vial

Anti-TMEM88 Antibody Picoband®

Sign In for Pricing
View Details