Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RNF113A Rabbit Polyclonal Antibody (HRP)

RNF113A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

TTD5, Cwc24, RNF113, ZNF183

UniProt

O15541

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human RNF113A

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VVRPEKKRVTHNPMIQKTRDSGKQKAAYGDLSSEEEEENEPESLGVVYKS

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_008909

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human TPSG1 shRNA (UAS) - Lentiviral human TPSG1 shRNA (UAS, iRFP) (25)
GTR15283970 1 Vial

Lentiviral human TPSG1 shRNA (UAS) - Lentiviral human TPSG1 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Anti-PEX16 Antibody Picoband® FITC Conjugated
A06382-1-FITC 100 µg/Vial

Anti-PEX16 Antibody Picoband® FITC Conjugated

Sign In for Pricing
View Details
Recombinant Human Small integral membrane protein 42 (SIM42), partial
orb3006574-01 20 µg

Recombinant Human Small integral membrane protein 42 (SIM42), partial

Sign In for Pricing
View Details
Recombinant Human Small integral membrane protein 42 (SIM42), partial
orb3006574-02 100 µg

Recombinant Human Small integral membrane protein 42 (SIM42), partial

Sign In for Pricing
View Details
Recombinant Human Small integral membrane protein 42 (SIM42), partial
orb3006574-03 1 mg

Recombinant Human Small integral membrane protein 42 (SIM42), partial

Sign In for Pricing
View Details
Rabbit anti-POLR2L Antibody
MBS4508097-01 0.05 mL

Rabbit anti-POLR2L Antibody

Sign In for Pricing
View Details